SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31657140|ref|NP_055030.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31657140|ref|NP_055030.1|
Domain Number 1 Region: 952-1244
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-76
Family Protein kinases, catalytic subunit 0.00000000144
Further Details:      
 
Domain Number 2 Region: 322-484
Classification Level Classification E-value
Superfamily L domain-like 3.97e-44
Family L domain 0.00000244
Further Details:      
 
Domain Number 3 Region: 28-161,222-237
Classification Level Classification E-value
Superfamily L domain-like 2.01e-37
Family L domain 0.00000357
Further Details:      
 
Domain Number 4 Region: 482-602
Classification Level Classification E-value
Superfamily Fibronectin type III 1.51e-23
Family Fibronectin type III 0.0000349
Further Details:      
 
Domain Number 5 Region: 762-910
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-23
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 6 Region: 604-672,773-795
Classification Level Classification E-value
Superfamily Fibronectin type III 9.22e-18
Family Fibronectin type III 0.00027
Further Details:      
 
Domain Number 7 Region: 191-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|31657140|ref|NP_055030.1|
Sequence length 1297
Comment insulin receptor-related protein precursor [Homo sapiens]
Sequence
MAVPSLWPWGACLPVIFLSLGFGLDTVEVCPSLDIRSEVAELRQLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGTRLFLGYALVIFEM
PHLRDVALPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPGANHIVGNKLGEECADVC
PGVLGAAGEPCAKTTFSGHTDYRCWTSSHCQRVCPCPHGMACTARGECCHTECLGGCSQP
EDPRACVACRHLYFQGACLWACPPGTYQYESWRCVTAERCASLHSVPGRASTFGIHQGSC
LAQCPSGFTRNSSSIFCHKCEGLCPKECKVGTKTIDSIQAAQDLVGCTHVEGSLILNLRQ
GYNLEPQLQHSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDAMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTRGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEADRILLRWERYEPLEARDLLSFIVYYKESPFQNATEHVGPDACGT
QSWNLLDVELPLSRTQEPGVTLASLKPWTQYAVFVRAITLTTEEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPTQRNGNLTYYLVLWQRLAEDGDLYLNDYCHRG
LRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPISPWKVTSINKSPQRDSGRHRRAAGPLRLGGNSSDFEIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEASSKNSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYILGPEEEDAGGLHVLLTATPVGLTLLIVLAALGFFYGKKRNRTLYASVNPEY
FSASDMYVPDEWEVPREQISIIRELGQGSFGMVYEGLARGLEAGEESTPVALKTVNELAS
PRECIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSHLRSLRPEAEN
NPGLPQPALGEMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELEGCPLQLQELMSRCWQPNPRLRPSFTHILDSIQEELRPSFRLLSFY
YSPECRGARGSLPTTDAEPDSSPTPRDCSPQNGGPGH
Download sequence
Identical sequences P14616
ENSP00000357178 gi|31657140|ref|NP_055030.1| ENSP00000357178 9606.ENSP00000357178 NP_055030.1.87134 NP_055030.1.92137 ENSP00000357178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]