SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317008611|ref|NP_001186930.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317008611|ref|NP_001186930.1|
Domain Number 1 Region: 413-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 911-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000122
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 757-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000227
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 4 Region: 594-716
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 1089-1220
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000111
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 948-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 7 Region: 1025-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000021
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 8 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000336
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 9 Region: 783-916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 10 Region: 286-461
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000051
Family EGF-type module 0.016
Further Details:      
 
Domain Number 12 Region: 260-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000661
Family EGF-type module 0.021
Further Details:      
 
Domain Number 13 Region: 983-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000927
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 14 Region: 181-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000945
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 15 Region: 67-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000262
Family EGF-type module 0.02
Further Details:      
 
Domain Number 17 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000367
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 18 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 19 Region: 1065-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000579
Family EGF-type module 0.02
Further Details:      
 
Domain Number 20 Region: 27-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000402
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|317008611|ref|NP_001186930.1|
Domain Number - Region: 576-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317008611|ref|NP_001186930.1|
Sequence length 1235
Comment neurogenic locus notch homolog protein 2 isoform 2 precursor [Homo sapiens]
Sequence
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGMKSSLSIFHPGHCLKL
Download sequence
Identical sequences NP_001186930.1.87134 NP_001186930.1.92137 ENSP00000477065 gi|317008611|ref|NP_001186930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]