SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|318037447|ref|NP_001186958.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|318037447|ref|NP_001186958.1|
Domain Number 1 Region: 30-348
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.16e-111
Family Bee venom hyaluronidase 0.0000142
Further Details:      
 
Weak hits

Sequence:  gi|318037447|ref|NP_001186958.1|
Domain Number - Region: 389-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00407
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|318037447|ref|NP_001186958.1|
Sequence length 417
Comment hyaluronidase-3 isoform 1 precursor [Homo sapiens]
Sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
Download sequence
Identical sequences A0A024R2Y7 O43820
NP_001186958.1.87134 NP_001186958.1.92137 NP_003540.2.87134 NP_003540.2.92137 9606.ENSP00000337425 ENSP00000337425 ENSP00000458171 ENSP00000337425 ENSP00000479935 gi|15208651|ref|NP_003540.2| gi|318037447|ref|NP_001186958.1| ENSP00000337425 ENSP00000458171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]