SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|318037451|ref|NP_001186959.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|318037451|ref|NP_001186959.1|
Domain Number 1 Region: 30-318
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.69e-95
Family Bee venom hyaluronidase 0.0000385
Further Details:      
 
Weak hits

Sequence:  gi|318037451|ref|NP_001186959.1|
Domain Number - Region: 359-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00356
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|318037451|ref|NP_001186959.1|
Sequence length 387
Comment hyaluronidase-3 isoform 2 precursor [Homo sapiens]
Sequence
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQEE
CWHLHDYLVDTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDW
KSFSCHCYWGWAGPTCQEPRPGPKEAV
Download sequence
Identical sequences ENSP00000351946 ENSP00000391922 ENSP00000458620 NP_001186959.1.87134 NP_001186959.1.92137 ENSP00000351946 ENSP00000391922 gi|318037451|ref|NP_001186959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]