SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|318037459|ref|NP_001186961.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|318037459|ref|NP_001186961.1|
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.0000000000206
Family Bee venom hyaluronidase 0.022
Further Details:      
 
Weak hits

Sequence:  gi|318037459|ref|NP_001186961.1|
Domain Number - Region: 110-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000755
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|318037459|ref|NP_001186961.1|
Sequence length 138
Comment hyaluronidase-3 isoform 4 [Homo sapiens]
Sequence
MLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQEECWHLHDYLV
DTLGPYVINVTRAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYW
GWAGPTCQEPRPGPKEAV
Download sequence
Identical sequences ENSP00000424633 gi|318037459|ref|NP_001186961.1| NP_001186961.1.87134 NP_001186961.1.92137 ENSP00000424633 ENSP00000460809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]