SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|318984125|ref|NP_001188295.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|318984125|ref|NP_001188295.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily L domain-like 1.6e-33
Family Internalin LRR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|318984125|ref|NP_001188295.1|
Sequence length 151
Comment dynein light chain 1, axonemal isoform 2 [Homo sapiens]
Sequence
MDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELW
ISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAE
NNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Download sequence
Identical sequences ENSP00000451834 gi|318984125|ref|NP_001188295.1| NP_001188295.1.87134 NP_001188295.1.92137 XP_016877168.1.92137 ENSP00000439695 ENSP00000451834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]