SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319084483|ref|NP_001188309.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319084483|ref|NP_001188309.1|
Domain Number 1 Region: 38-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 153-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.2e-36
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 338-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-35
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 783-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-35
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 969-1173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.88e-30
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 6 Region: 577-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000109
Family Fibrinogen C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 7 Region: 549-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000088
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319084483|ref|NP_001188309.1|
Sequence length 1288
Comment contactin-associated protein-like 3B [Homo sapiens]
Sequence
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDSPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYTLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSNLDLNFEISFGGILSPGRSRAFTRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELQRGSGSFV
LFLKDGKLKLSLFQAGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGGCLGNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGALGSFRDL
QIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGN
PSGLYYIDADGSGPLGPFLVYCNMTADSAWTVVRHGGPDAVTLRGAPSGHPLSAVSFAYA
AGAGQLRAAVNLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTSWGGSLPDAQ
KCTCGLEGNCIDSQYYCNCDAGQNEWTSDTIVLSQKEHLPVTQIVMTDTGQPHSEADYTL
GPLLCRGDKSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFI
RIELRAPTEVTFSFDVGNGPCEVTVQSPTPFNDNQWHHVRAERNVKGASLQVDQLPQKMQ
PAPADGHVRLQLNSQLFIGGTATRQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAG
HCSTYGHLCRNGGRCREKRRGVTCDCAFSAYDGPFCSNEISAYFATGSSMTYHFQEHYTL
SENSSSLVSSLYRDVTLTREMITLSFRTTRSPSLLLYVSSFYEEYLSVILANNGSLQIRY
KLDRHQNPDAFTFDFKNMADGQLHQVKINREEAVVMVEVNQSAKKQVILSSGTEFNAVKS
LILGKVLEAAGADPDTRRAATSGFTGCLSAVRFGRAAPLKAALRPSGPSRVTVRGHVAPM
ARCAAGAASGSPARELAPRLAGGAGRSGPVDEGEPLVNADRRDSAVMGGVIAVVIFILLC
ITAIAIRIYQQRKLRKENESKVSKKEEC
Download sequence
Identical sequences 9606.ENSP00000366787 ENSP00000276974 gi|319084483|ref|NP_001188309.1| ENSP00000366787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]