SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320118911|ref|NP_058634.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320118911|ref|NP_058634.4|
Domain Number 1 Region: 162-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.67e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 33-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000502
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|320118911|ref|NP_058634.4|
Domain Number - Region: 278-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000158
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320118911|ref|NP_058634.4|
Sequence length 443
Comment EGF-containing fibulin-like extracellular matrix protein 2 precursor [Homo sapiens]
Sequence
MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCINEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYIQVSENRCLCPASNPLCREQPSSIVHRYMTITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences A0A024R5G1 O95967
NP_058634.4.87134 NP_058634.4.92137 ENSP00000309953 ENSP00000435295 ENSP00000309953 gi|320118911|ref|NP_058634.4| HR6290 9606.ENSP00000309953 ENSP00000309953 ENSP00000435295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]