SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320461689|ref|NP_569059.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320461689|ref|NP_569059.3|
Domain Number 1 Region: 16-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-36
Family Ankyrin repeat 0.00052
Further Details:      
 
Weak hits

Sequence:  gi|320461689|ref|NP_569059.3|
Domain Number - Region: 269-315
Classification Level Classification E-value
Superfamily SOCS box-like 0.000693
Family SOCS box-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320461689|ref|NP_569059.3|
Sequence length 318
Comment ankyrin repeat and SOCS box protein 12 [Homo sapiens]
Sequence
MRIVLQLAKMNLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERY
KRFINSRSGWGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLD
CVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELLDHGAEANVKAKLPVWASNIAS
CSGPLYLAAVYGHLDCFRLLLLHGADPDYNCTDQGLLARVPRPRTLLEICLHHNCEPEYI
QLLIDFGANIYLPSLSLDLTSQDDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQA
INQLDIPPMLISYLKHQL
Download sequence
Identical sequences ENSP00000355195 ENSP00000355195 ENSP00000379435 NP_569059.3.87134 NP_569059.3.92137 gi|320461689|ref|NP_569059.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]