SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32129214|ref|NP_061938.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32129214|ref|NP_061938.2|
Domain Number 1 Region: 281-370
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 4.03e-17
Family PG130-like 0.042
Further Details:      
 
Domain Number 2 Region: 62-129
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000922
Family Calmodulin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32129214|ref|NP_061938.2|
Sequence length 386
Comment N-terminal EF-hand calcium-binding protein 2 [Homo sapiens]
Sequence
MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
KVDTLSQPEALSRILVPAAWCTVGRD
Download sequence
Identical sequences Q7Z6G3
ENSP00000307449 NP_061938.2.87134 NP_061938.2.92137 ENSP00000307449 9606.ENSP00000307449 ENSP00000307449 gi|32129214|ref|NP_061938.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]