SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32171205|ref|NP_859074.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32171205|ref|NP_859074.1|
Domain Number 1 Region: 351-500
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000039
Family Calmodulin-like 0.065
Further Details:      
 
Domain Number 2 Region: 185-278,332-366
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000203
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32171205|ref|NP_859074.1|
Sequence length 530
Comment EF-hand domain-containing family member A2 [Homo sapiens]
Sequence
MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRR
RRRWGELSVAAAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP
VAAAKETVAIGRTDIEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVA
KTWKSLSKQELNQMLAETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGFRIA
FNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKT
DAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKKGKAELNFEDF
YRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKG
ITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFK
IFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR
Download sequence
Identical sequences Q86XE3
NYSGRC-32171205 ENSP00000321455 ENSP00000321455 gi|32171205|ref|NP_859074.1| ENSP00000321455 NP_859074.1.87134 NP_859074.1.92137 9606.ENSP00000321455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]