SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32189392|ref|NP_005800.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32189392|ref|NP_005800.3|
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.5e-128
Family Glutathione peroxidase-like 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32189392|ref|NP_005800.3|
Sequence length 198
Comment peroxiredoxin-2 isoform a [Homo sapiens]
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKT
DEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGS
DTIKPNVDDSKEYFSKHN
Download sequence
Identical sequences A0A0A0MXF6 A0A0D9R2M0 A0A2K5HFI2 A0A2K5LJK2 A0A2K5XEX2 A0A2K6DRB8 A0A2K6Q0K4 G3S156 G7NLB5 H2QFG9 P32119 Q2PFZ3 V9HW12
ENSPTRP00000017998 5ijt_A 5ijt_B 5ijt_C 5ijt_D 5ijt_E 5ijt_F 5ijt_G 5ijt_H 5ijt_I 5ijt_J ENSPTRP00000017998 ENSMMUP00000007512 gi|32189392|ref|NP_005800.3| ENSP00000301522 ENSP00000301522 ENSP00000301522 ENSGGOP00000021801 9544.ENSMMUP00000007512 9598.ENSPTRP00000017998 9606.ENSP00000301522 ENSMMUP00000007512 ENSGGOP00000021801 NP_001248186.1.72884 NP_005800.3.87134 NP_005800.3.92137 XP_003814872.1.60992 XP_004060144.1.27298 XP_007993618.1.81039 XP_010359942.1.97406 XP_010359943.1.97406 XP_011713068.1.29376 XP_011810104.1.43180 XP_011850314.1.47321 XP_011885872.1.92194 XP_011949410.1.92194 XP_016790684.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]