SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322302755|ref|NP_001189788.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322302755|ref|NP_001189788.1|
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-55
Family Phosphotyrosine-binding domain (PTB) 0.0000000393
Further Details:      
 
Domain Number 2 Region: 316-421
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-28
Family SH2 domain 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322302755|ref|NP_001189788.1|
Sequence length 428
Comment SHC-transforming protein 1 isoform 5 precursor [Homo sapiens]
Sequence
MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRP
LSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVA
YVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGS
AWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLP
VGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAP
RDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTT
TPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCL
QQPVERKL
Download sequence
Identical sequences gi|322302755|ref|NP_001189788.1| NP_001189788.1.87134 NP_001189788.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]