SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276630|ref|NP_001190995.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276630|ref|NP_001190995.1|
Domain Number 1 Region: 123-288
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 49-95
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000216
Family SAM (sterile alpha motif) domain 0.0078
Further Details:      
 
Domain Number 3 Region: 2-46
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000011
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323276630|ref|NP_001190995.1|
Sequence length 357
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform e [Homo sapiens]
Sequence
MANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAE
WLDSIELGDYTKAFLINGYTSMDLLKKIWEVELINQSSVCEIWTNQNAGFPFSAIHQVHN
TGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQ
DACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPED
LSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLP
ESFENKPSKPIPKPRVSIRKSVIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences A0A286Y0T6 A0A287D223 A0A2I2Z5B6 A0A2I3GSK0 A0A2I3M4J8 A0A2I3TP67 A0A2J8XMM7 A0A2K5HGB6 A0A2K5MAB1 A0A2K5V510 A0A2K5Z579 A0A2K6E9D4 A0A2K6FUH0 A0A2K6M540 A0A2K6REB3 F6YRR8
ENSP00000447312 NP_001190995.1.87134 NP_001190995.1.92137 XP_004403927.1.74151 XP_006876007.1.41390 XP_006914640.1.64745 XP_007945386.1.48129 XP_010354248.1.97406 XP_010597875.1.64505 XP_011789926.1.43180 XP_011847626.1.47321 XP_012355591.1.23891 XP_012519482.1.63892 XP_012656681.1.62490 XP_015338383.1.40921 ENSP00000447312 gi|323276630|ref|NP_001190995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]