SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276636|ref|NP_001190998.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276636|ref|NP_001190998.1|
Domain Number 1 Region: 215-380
Classification Level Classification E-value
Superfamily PH domain-like 9.57e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 32-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.68e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 106-169
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.79e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323276636|ref|NP_001190998.1|
Sequence length 450
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform h [Homo sapiens]
Sequence
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMAN
GFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLD
SIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQK
PPRSITLRSSVCEIWTNQNAGFPFSAIHQVHNTGDWGEPSITLRPPNEATASTPVQYWQH
HPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVS
YKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNL
AYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSE
QKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences A0A1D5R008 A0A2I2YQN7 A0A2I3G4H2 A0A2I3LI43 A0A2I3TB66 A0A2J8XMZ3 A0A2K5HGB2 A0A2K5MAC6 A0A2K5V4Z6 A0A2K5Z570 A0A2K6E9A9 A0A2K6RE61
NP_001190998.1.87134 NP_001190998.1.92137 XP_003259761.1.23891 XP_003405333.1.64505 XP_004381319.1.4749 XP_004403924.1.74151 XP_006077495.1.26621 XP_006876004.1.41390 XP_007945382.1.48129 XP_008002548.1.81039 XP_008685961.1.72690 XP_010354244.1.97406 XP_010829887.1.44457 XP_011789889.1.43180 XP_011847622.1.47321 XP_011888162.1.92194 XP_015008000.1.72884 XP_015338378.1.40921 XP_021543025.1.83697 ENSP00000447999 ENSP00000447999 gi|323276636|ref|NP_001190998.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]