SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276638|ref|NP_001190999.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276638|ref|NP_001190999.1|
Domain Number 1 Region: 191-356
Classification Level Classification E-value
Superfamily PH domain-like 8.47e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 32-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.09e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 106-169
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323276638|ref|NP_001190999.1|
Sequence length 426
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform i [Homo sapiens]
Sequence
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMAN
GFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLD
SIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQK
PPRSITLRTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKE
LRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNIS
CAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARK
GGHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTK
YETTIF
Download sequence
Identical sequences A0A287D3U4 A0A2I3GIC9 A0A2J8N0G7 A0A2J8XMN0 H9FXB9 Q4R4X1
ENSP00000448205 NP_001190999.1.87134 NP_001190999.1.92137 XP_003259758.1.23891 XP_003313923.1.37143 XP_004006692.1.66739 XP_004403925.1.74151 XP_004418059.1.5094 XP_004743005.1.14098 XP_005206757.1.76553 XP_005572020.1.63531 XP_005680548.1.57651 XP_006077496.1.26621 XP_006876005.1.41390 XP_007945383.1.48129 XP_008002549.1.81039 XP_008685962.1.72690 XP_010354245.1.97406 XP_010597863.1.64505 XP_010829888.1.44457 XP_011224594.1.58354 XP_011282469.1.62641 XP_011708719.1.29376 XP_011789898.1.43180 XP_011847623.1.47321 XP_011888164.1.92194 XP_012412376.1.4749 XP_015008001.1.72884 XP_015338379.1.40921 XP_018894398.1.27298 XP_019302090.1.44245 XP_021543027.1.83697 XP_539738.3.84170 gi|323276638|ref|NP_001190999.1| ENSP00000448205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]