SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276659|ref|NP_001191008.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276659|ref|NP_001191008.1|
Domain Number 1 Region: 56-221
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323276659|ref|NP_001191008.1|
Sequence length 290
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform j [Homo sapiens]
Sequence
MQGDARRRRNENYFDDIPRSKLERQMAQQSSVCEIWTNQNAGFPFSAIHQVHNTGDWGEP
SITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMR
ANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYI
TKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKP
SKPIPKPRVSIRKSVIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences gi|323276659|ref|NP_001191008.1| NP_001191008.1.87134 NP_001191008.1.92137 XP_004418062.1.5094 XP_004700430.1.18182 XP_005322448.1.77405 XP_005572024.1.63531 XP_005962141.1.78601 XP_006773402.1.95426 XP_006876009.1.41390 XP_006914641.1.64745 XP_007945387.1.48129 XP_009424347.1.37143 XP_010354250.1.97406 XP_011708726.1.29376 XP_011888169.1.92194 XP_012412377.1.4749 XP_012519484.1.63892 XP_012656683.1.62490 XP_013014657.1.53824 XP_014926335.1.86478 XP_015008005.1.72884 XP_015338384.1.40921 XP_015394584.1.5354 XP_017903633.1.57651 XP_018894401.1.27298 XP_019497261.1.44202 XP_020024748.1.5219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]