SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276661|ref|NP_001191009.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276661|ref|NP_001191009.1|
Domain Number 1 Region: 31-196
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323276661|ref|NP_001191009.1|
Sequence length 266
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform k [Homo sapiens]
Sequence
MQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEK
LIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGV
KFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEI
ILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTL
ANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences gi|323276661|ref|NP_001191009.1| NP_001191009.1.87134 NP_001191009.1.92137 XP_004418063.1.5094 XP_004623884.1.9945 XP_005269089.1.92137 XP_005322449.1.77405 XP_005572025.1.63531 XP_005962139.1.78601 XP_006773404.1.95426 XP_006876010.1.41390 XP_007085714.1.5354 XP_007945389.1.48129 XP_009424348.1.37143 XP_009424349.1.37143 XP_010354251.1.97406 XP_011708727.1.29376 XP_011708728.1.29376 XP_011708729.1.29376 XP_011888170.1.92194 XP_011888171.1.92194 XP_011888172.1.92194 XP_012419024.1.74151 XP_012519485.1.63892 XP_012656684.1.62490 XP_013014658.1.53824 XP_014926336.1.86478 XP_015008006.1.72884 XP_017903634.1.57651 XP_018894402.1.27298 XP_019497262.1.44202 XP_020948676.1.46622 XP_020948677.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]