SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323276663|ref|NP_001191010.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323276663|ref|NP_001191010.1|
Domain Number 1 Region: 31-196
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|323276663|ref|NP_001191010.1|
Sequence length 254
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform l [Homo sapiens]
Sequence
MQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATASTPVQYWQHHPEK
LIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGV
KFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEI
ILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQ
EPSERHTEEALRKF
Download sequence
Identical sequences A0A2J8N0G5 A0A2J8XMP2 F7C771
ENSP00000345510 ENSCJAP00000004144 gi|323276663|ref|NP_001191010.1| NP_001191010.1.87134 NP_001191010.1.92137 XP_003313927.1.37143 XP_009002689.1.60252 XP_017366646.1.71028 XP_018894403.1.27298 ENSP00000345510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]