SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|324072825|ref|NP_001191282.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|324072825|ref|NP_001191282.1|
Domain Number 1 Region: 80-200
Classification Level Classification E-value
Superfamily EF-hand 4.9e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.71e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 9-63
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000291
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|324072825|ref|NP_001191282.1|
Domain Number - Region: 275-313
Classification Level Classification E-value
Superfamily ARM repeat 0.0282
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|324072825|ref|NP_001191282.1|
Sequence length 316
Comment testican-3 isoform 4 [Homo sapiens]
Sequence
MKEAGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCE
GHCPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE
DEGDDDDGGDDHDVYI
Download sequence
Identical sequences gi|324072825|ref|NP_001191282.1| ENSP00000444789 ENSP00000444789 NP_001191282.1.87134 NP_001191282.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]