SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|324072828|ref|NP_001191283.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|324072828|ref|NP_001191283.1|
Domain Number 1 Region: 108-228
Classification Level Classification E-value
Superfamily EF-hand 5.91e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 197-290
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.49e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 37-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000333
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|324072828|ref|NP_001191283.1|
Domain Number - Region: 303-341
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|324072828|ref|NP_001191283.1|
Sequence length 344
Comment testican-3 isoform 5 [Homo sapiens]
Sequence
MKCSRHKVCIAQDSQTAVCISHRRLTHRMKEAGVDHRQWRGPILSTCKQCPVVYPSPVCG
SDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVANR
LRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSE
LRSIYLDKNEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKK
LLGQYIPLCDEDGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFAS
GDFHEWTDDEDDEDDIMNDEDEIEDDDEDEGDDDDGGDDHDVYI
Download sequence
Identical sequences A0A0A0MTJ2
ENSP00000441396 gi|324072828|ref|NP_001191283.1| NP_001191283.1.87134 NP_001191283.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]