SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|324120878|ref|NP_001191285.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|324120878|ref|NP_001191285.1|
Domain Number 1 Region: 189-277
Classification Level Classification E-value
Superfamily EF-hand 2.59e-29
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 246-339
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.06e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 126-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000402
Family Ovomucoid domain III-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|324120878|ref|NP_001191285.1|
Sequence length 393
Comment testican-3 isoform 7 [Homo sapiens]
Sequence
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKE
AGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHC
PCPSDKPTSTSRNVKRGFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQ
CTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDE
DGYYKPTQCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDED
DEDDIMNDEDEIEDDDEDEGDDDDGGDDHDVYI
Download sequence
Identical sequences ENSP00000426716 ENSP00000426716 gi|324072917|ref|NP_001191286.1| gi|324120878|ref|NP_001191285.1| NP_001191285.1.87134 NP_001191285.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]