SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32441283|ref|NP_689876.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32441283|ref|NP_689876.2|
Domain Number 1 Region: 32-290
Classification Level Classification E-value
Superfamily Ras GEF 6.15e-81
Family Ras GEF 0.0000421
Further Details:      
 
Domain Number 2 Region: 458-576
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000364
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32441283|ref|NP_689876.2|
Sequence length 583
Comment ras-specific guanine nucleotide-releasing factor RalGPS2 [Homo sapiens]
Sequence
MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLM
DVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEV
LSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKE
DNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIIS
DLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYKLSLKIEPGTSTPRSAASREDL
VGPEVGASPQSGRKSVAAEGALLPQTPPSPRNLIPHGHRKCHSLGYNFIHKMNTAEFKSA
TFPNAGPRHLLDDSVMEPHAPSRGQAESSTLSSGISIGSSDGSELSEETSWPAFERNRLY
HSLGPVTRVARNGYRSHMKASSSAESEDLAVHLYPGAVTIQGVLRRKTLLKEGKKPTVAS
WTKYWAALCGTQLFYYAAKSLKATERKHFKSTSNKNVSVIGWMVMMADDPEHPDLFLLTD
SEKGNSYKFQAGNRMNAMLWFKHLSAACQSNKQQVPTNLMTFE
Download sequence
Identical sequences Q86X27
NP_689876.2.87134 NP_689876.2.92137 XP_006711473.1.92137 gi|32441283|ref|NP_689876.2| 9606.ENSP00000356607 ENSP00000356607 ENSP00000356607 ENSP00000313613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]