SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|329112583|ref|NP_001192248.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|329112583|ref|NP_001192248.1|
Domain Number 1 Region: 67-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.21e-28
Family Glutathione peroxidase-like 0.00046
Further Details:      
 
Domain Number 2 Region: 199-325
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000282
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|329112583|ref|NP_001192248.1|
Sequence length 327
Comment nucleoredoxin isoform 2 [Homo sapiens]
Sequence
MADVSLHRNPATLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPK
PFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQN
FEIIFVSADRSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVI
TRQGRVEVLNDEDCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLI
QPIAEKIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVM
DVEEITPAIVEAFVNDFLAEKLKPEPI
Download sequence
Identical sequences gi|329112583|ref|NP_001192248.1| ENSP00000461038 NP_001192248.1.87134 NP_001192248.1.92137 ENSP00000461038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]