SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967260|ref|NP_861966.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967260|ref|NP_861966.1|
Domain Number 1 Region: 173-314
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-42
Family Third domain of FERM 0.000000424
Further Details:      
 
Domain Number 2 Region: 65-172
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-38
Family Second domain of FERM 0.000000679
Further Details:      
 
Domain Number 3 Region: 461-539
Classification Level Classification E-value
Superfamily Moesin tail domain 4.45e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32967260|ref|NP_861966.1|
Sequence length 548
Comment merlin isoform 5 [Homo sapiens]
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVLDHDVSKEEPVTFHFLAKFYP
ENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGF
LAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYF
AIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDV
FKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLARE
KQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKA
AEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAR
EAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIE
KEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKPQA
QGRRPICI
Download sequence
Identical sequences A0A024R1I0 A0A2I2Y2Y4 A0A2K5P528 A0A2K5WC58 A0A2K5XBT3 A0A2K6NI69
ENSMMUP00000013513 NP_861966.1.87134 NP_861966.1.92137 XP_010357732.1.97406 XP_011851098.1.47321 gi|32967260|ref|NP_861966.1| ENSP00000355183 ENSP00000355183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]