SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967268|ref|NP_861971.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967268|ref|NP_861971.1|
Domain Number 1 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-26
Family First domain of FERM 0.00000532
Further Details:      
 
Domain Number 2 Region: 107-150
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000746
Family Second domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32967268|ref|NP_861971.1|
Sequence length 165
Comment merlin isoform 8 [Homo sapiens]
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKLTLQSAKSRVAFFEEL
Download sequence
Identical sequences A0A2I2ZNL6 A0A2I3GMK0 A0A2I3LLH3 A0A2I3R9Z1 A0A2J8UUW7 A0A2K5BVQ7 A0A2K5P523 A0A2K5XBR2 A0A2K6FAV5 A0A2K6LL77 A0A2K6NI97 F6UTG8
ENSCJAP00000051899 ENSP00000409921 NP_861971.1.87134 NP_861971.1.92137 XP_006869287.1.41390 XP_006894831.1.29581 XP_007946164.1.48129 XP_011851101.1.47321 XP_012363396.1.23891 XP_012393656.1.21590 XP_012411740.1.4749 XP_012863342.1.18182 gi|32967268|ref|NP_861971.1| ENSP00000409921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]