SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967514|ref|NP_861969.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967514|ref|NP_861969.1|
Domain Number 1 Region: 132-273
Classification Level Classification E-value
Superfamily PH domain-like 1.33e-42
Family Third domain of FERM 0.000000424
Further Details:      
 
Domain Number 2 Region: 35-131
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-32
Family Second domain of FERM 0.00000179
Further Details:      
 
Domain Number 3 Region: 420-498
Classification Level Classification E-value
Superfamily Moesin tail domain 3.92e-20
Family Moesin tail domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|32967514|ref|NP_861969.1|
Sequence length 507
Comment merlin isoform 7 [Homo sapiens]
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVKKQILDEKIYCPPEASVLLAS
YAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEA
EMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRN
ISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKA
QAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADL
LAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEE
SERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGD
SLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHN
ENSDRGGSSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences A0A024R1D9 A0A2I2YXH3 A0A2K5P512 A0A2K5WC56 A0A2K5XBN2 A0A2K6D2A4 A0A2K6NIA1 F6RPZ9
ENSP00000335652 ENSP00000340626 ENSMMUP00000013516 NP_861968.1.87134 NP_861968.1.92137 NP_861969.1.87134 NP_861969.1.92137 XP_011851099.1.47321 XP_011851100.1.47321 gi|32967264|ref|NP_861968.1| gi|32967514|ref|NP_861969.1| ENSP00000335652 ENSP00000340626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]