SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967586|ref|NP_871626.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967586|ref|NP_871626.1|
Domain Number 1 Region: 263-428
Classification Level Classification E-value
Superfamily EF-hand 9.12e-26
Family Calmodulin-like 0.018
Further Details:      
 
Domain Number 2 Region: 105-251
Classification Level Classification E-value
Superfamily EF-hand 7.69e-17
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32967586|ref|NP_871626.1|
Sequence length 529
Comment serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform 2 [Homo sapiens]
Sequence
MMIKETSLRRDPDLRGELAFLARGCDFVLPSRFKKRLKSFQQTQIQNKPEKKPGTPLPPP
ATSPSSPRPLSPVPHVNNVVNAPLSINIPRFYFPEGLPDTCSNHEQTLSRIETAFMDIEE
QKADIYEMGKIAKVCGCPLYWKAPMFRAAGGEKTGFVTAQSFIAMWRKLLNNHHDDASKF
ICLLAKPNCSSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQRIFYTVNRSW
SGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELDTDHDLYISQA
DLSRYNDQASSSRIIERIFSGAVTRGKTIQKEGRMSYADFVWFLISEEDKRNPTSIEYWF
RCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKPAVDGKITLRD
LKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEE
SAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE
Download sequence
Identical sequences gi|32967586|ref|NP_871626.1| ENSP00000334748 ENSP00000334748 NP_871626.1.87134 NP_871626.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]