SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|32967591|ref|NP_002588.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|32967591|ref|NP_002588.3|
Domain Number 1 Region: 17-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.61e-55
Family Phosducin 0.00000000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|32967591|ref|NP_002588.3|
Sequence length 246
Comment phosducin isoform a [Homo sapiens]
Sequence
MEEAKSQSLEEDFEGQATHTGPKGVINDWRKFKLESQDSDSIPPSKKEILRQMSSPQSRN
GKDSKERVSRKMSIQEYELIHKEKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG
KQFLETIEKELKITTIVVHIYEDGIKGCDALNSSLTCLAAEYPIVKFCKIKASNTGAGDR
FSLDVLPTLLIYKGGELISNFISVAEQFAEEFFAGDVESFLNEYGLLPEREVHVLEHTKI
EEEDVE
Download sequence
Identical sequences P20941
9606.ENSP00000375855 ENSP00000342033 ENSP00000375855 NP_002588.3.87134 NP_002588.3.92137 XP_011507905.1.92137 gi|32967591|ref|NP_002588.3| ENSP00000342033 ENSP00000375855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]