SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33149331|ref|NP_071908.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33149331|ref|NP_071908.2|
Domain Number 1 Region: 175-292
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.31e-27
Family Glutathione peroxidase-like 0.00046
Further Details:      
 
Domain Number 2 Region: 307-433
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000582
Family PDI-like 0.013
Further Details:      
 
Domain Number 3 Region: 12-145
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000023
Family Glutathione peroxidase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33149331|ref|NP_071908.2|
Sequence length 435
Comment nucleoredoxin isoform 1 [Homo sapiens]
Sequence
MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRL
RGDAAAGPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRK
LKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
NNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSE
ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIMLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNAAQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA
FVNDFLAEKLKPEPI
Download sequence
Identical sequences K7DKH1 Q6DKJ4
ENSP00000337443 gi|33149331|ref|NP_071908.2| ENSP00000337443 9606.ENSP00000337443 ENSP00000337443 NP_071908.2.87134 NP_071908.2.92137 XP_016786604.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]