SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33186895|ref|NP_874363.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33186895|ref|NP_874363.1|
Domain Number 1 Region: 263-336
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000154
Family Selenoprotein W-related 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33186895|ref|NP_874363.1|
Sequence length 346
Comment selenoprotein V [Homo sapiens]
Sequence
MNNQARTPAPSSARTSTSVRASTPTRTPTPLRTPTPVRTRTPIRTLTPVLTPSPAGTSPL
VLTPAPAQIPTLVPTPALARIPRLVPPPAPAWIPTPVPTPVPVRNPTPVPTPARTLTPPV
RVPAPAPAQLLAGIRAALPVLDSYLAPALPLDPPPEPAPELPLLPEEDPEPAPSLKLIPS
VSSEAGPAPGPLPTRTPLAANSPGPTLDFTFRADPSAIGLADPPIPSPVPSPILGTIPSA
ISLQNCTETFPSSSENFALDKRVLIRVTYCGLUSYSLRYILLKKSLEQQFPNHLLFEEDR
AAQATGEFEVFVNGRLVHSKKRGDGFVNESRLQKIVSVIDEEIKKR
Download sequence
Identical sequences P59797
ENSP00000333956 gi|33186895|ref|NP_874363.1| ENSP00000333956 ENSP00000412508 NP_874363.1.87134 NP_874363.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]