SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33188454|ref|NP_859428.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33188454|ref|NP_859428.1|
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-34
Family Glutathione peroxidase-like 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33188454|ref|NP_859428.1|
Sequence length 142
Comment peroxiredoxin-2 isoform c [Homo sapiens]
Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSN
RAEDFRKLGCEVLGVSVDSQFTHLAWYEQGPKREVAAKLTPSGPSSVASWPLLNLWNLRF
PIVKIMETLPPKSLRMMTVISI
Download sequence
Identical sequences A0A024R7F2
gi|33188454|ref|NP_859428.1| ENSP00000408905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]