SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332078492|ref|NP_001193674.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332078492|ref|NP_001193674.1|
Domain Number 1 Region: 146-677
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-168
Family Myeloperoxidase-like 0.000000000614
Further Details:      
 
Domain Number 2 Region: 684-740
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000542
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 737-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000163
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332078492|ref|NP_001193674.1|
Sequence length 876
Comment thyroid peroxidase isoform b precursor [Homo sapiens]
Sequence
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPFVPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYIPRILGPEAFQQYVGPYEGYDSTANPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGYNEWREF
CGLPRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLI
GKQMKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPED
FESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGR
EQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRT
CVDSGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCG
KHQAVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL
Download sequence
Identical sequences gi|28558984|ref|NP_783650.1| gi|332078492|ref|NP_001193674.1| ENSP00000371636 NP_001193674.1.87134 NP_001193674.1.92137 NP_783650.1.87134 NP_783650.1.92137 ENSP00000371636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]