SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332078559|ref|NP_001193658.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332078559|ref|NP_001193658.1|
Domain Number 1 Region: 144-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-99
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-22
Family Pleckstrin-homology domain (PH domain) 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332078559|ref|NP_001193658.1|
Sequence length 465
Comment RAC-gamma serine/threonine-protein kinase isoform 2 [Homo sapiens]
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKCQQSDCGMLGNWKK
Download sequence
Identical sequences A0A2I3MN09 A0A2J8TDT1 A0A2K5E2X0 A0A2K5JHD7 A0A2K5M2Z0 A0A2K5V8J4 A0A2K6AAD0 A0A2K6DSQ2 A0A2K6GQK8 A0A2K6PXS4 A0A2K6U3T3 F7I5J9 G1QV33 G3SBI1 H2R7Z0
ENSP00000336943 ENSP00000355498 ENSP00000479922 ENSP00000483054 gi|32307163|ref|NP_859029.1| gi|332078559|ref|NP_001193658.1| NP_001193658.1.87134 NP_001193658.1.92137 NP_859029.1.87134 NP_859029.1.92137 XP_004284559.1.21590 XP_004626891.1.9945 XP_006157281.1.99106 XP_006157282.1.99106 XP_007462697.1.90284 XP_007462698.1.90284 XP_007988149.1.81039 XP_010351568.1.97406 XP_011811093.1.43180 XP_011811094.1.43180 XP_011836549.1.47321 XP_011891688.1.92194 XP_012362043.1.23891 XP_012393988.1.21590 XP_012499835.1.63892 XP_012499836.1.63892 XP_012666207.1.62490 XP_012666208.1.62490 XP_014982884.1.72884 ENSCJAP00000031494 ENSP00000336943 ENSP00000355498 ENSMMUP00000037508 ENSMMUP00000037509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]