SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33285015|ref|NP_653199.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33285015|ref|NP_653199.2|
Domain Number 1 Region: 14-250
Classification Level Classification E-value
Superfamily L domain-like 6.32e-38
Family Ngr ectodomain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33285015|ref|NP_653199.2|
Sequence length 367
Comment leucine-rich repeat-containing protein 28 [Homo sapiens]
Sequence
MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQYLERLYMKRNSLTSLPENL
AQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLAN
NQLQFLPPEVGDLKELQTLDISTNRLLTLPERLHMCLSLQYLTVDRNRLWYVPRHLCQLP
SLNELSMAGNRLAFLPLDLGRSRELQYVYVDNNIHLKGLPSYLYNKVIGCSGCGAPIQVS
EVKLLSFSSGQRTVFLPAEVKAIGTEHDHVLPLQELAMRGLYHTYHSLLKDLNFLSPISL
PRSLLELLHCPLGHCHRCSEPMFTIVYPKLFPLRETPMAGLHQWKTTVSFVAYCCSTQCL
QTFDLLS
Download sequence
Identical sequences Q86X40
gi|33285015|ref|NP_653199.2| 9606.ENSP00000304923 NP_001308604.1.87134 NP_001308604.1.92137 NP_653199.2.87134 NP_653199.2.92137 XP_011519520.1.92137 ENSP00000304923 ENSP00000304923 ENSP00000304923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]