SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33350928|ref|NP_066566.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33350928|ref|NP_066566.3|
Domain Number 1 Region: 29-173
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-40
Family Phosphotyrosine-binding domain (PTB) 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33350928|ref|NP_066566.3|
Sequence length 555
Comment disabled homolog 1 [Homo sapiens]
Sequence
MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKL
CQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDI
TDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQC
EQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPV
SAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLPASADVFSSVPFGTAAVPSGY
VAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPATQQPWPTVAGQ
FPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQM
AQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTN
SPPTPAPRQSSPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEP
SGEPSGDNISPQAGS
Download sequence
Identical sequences A0A2I2YZY4 A0A2I3TIA6
NP_066566.3.87134 NP_066566.3.92137 XP_001155092.3.37143 XP_008976210.1.60992 XP_008976211.1.60992 XP_009457073.2.37143 XP_018874612.1.27298 ENSP00000360280 ENSP00000387581 gi|33350928|ref|NP_066566.3| ENSP00000360278 ENSP00000360280 9606.ENSP00000360277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]