SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33359215|ref|NP_667340.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33359215|ref|NP_667340.2|
Domain Number 1 Region: 681-949
Classification Level Classification E-value
Superfamily VPS9 domain 2.88e-45
Family VPS9 domain 0.006
Further Details:      
 
Domain Number 2 Region: 432-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.37e-24
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 356-445
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.5e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.014
Further Details:      
 
Domain Number 4 Region: 12-213
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000374
Family DBL homology domain (DH-domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33359215|ref|NP_667340.2|
Sequence length 953
Comment ALS2 C-terminal-like protein isoform 1 [Homo sapiens]
Sequence
MCNPEEAALLRLEEVFSATLAHVNSLVLQPLLPAAPDPSDPWGRECLRLLQQLHKSSQQL
WEVTEESLHSLQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAK
RRSEYWRGQRKALRQLLSGVSSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHH
PTRELVVNAVTLFGNLQSFMKQELDQAVATQALWHTLRGRLRDVLCTPAHRLLQDSQDVP
VTVAPLRAERVLLFDDALVLLQGHNVHTFDLKLVWVDPGQDGCTFHLLTPEEEFSFCAKD
SQGQAVWQWKVTWAVHQALHGKKDFPVLGAGLEPSQPPDCRCAEYTFQAEGRLCQATYEG
EWCRGRPHGKGTLKWPDGRNHVGNFCQGLEHGFGIRLLPQASEDKFDCYKCHWREGSMCG
YGICEYSTDEVYKGYFQEGLRHGFGVLESGPQAPQPFRYTGHWERGQRSGYGIEEDGDRG
ERYIGMWQAGQRHGPGVMVTQAGVCYQGTFQADKTVGPGILLSEDDSLYEGTFTRDLTLM
GKGKVTFPNGFTLEGSFGSGAGRGLHTQGVLDTAALPPDPSSTCKRQLGVGAFPVESRWQ
GVYSPFRDFVCAGCPRDLQEALLGFDVQSSRELRRSQDYLSCERTHPEDSVGSMEDILEE
LLQHREPKALQLYLRKALSNSLHPLGKLLRTLMLTFQATYAGVGANKHLQELAQEEVKQH
AQELWAAYRGLLRVALERKGQALEEDEDTETRDLQVHGLVLPLMLPSFYSELFTLYLLLH
EREDSFYSQGIANLSLFPDTQLLEFLDVQKHLWPLKDLTLTSNQRYSLVRDKCFLSATEC
LQKIMTTVDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLG
AEIHLIRDMMDPNHTGGLYDFLLTALESCYEHIQKEDMRLHRLPGHWHSRELW
Download sequence
Identical sequences A0A024R2U1 Q60I27
ENSP00000313670 ENSP00000413223 gi|299523224|ref|NP_001177636.1| gi|33359215|ref|NP_667340.2| ENSP00000313670 9606.ENSP00000313670 ENSP00000313670 ENSP00000413223 NP_001177636.1.87134 NP_001177636.1.92137 NP_667340.2.87134 NP_667340.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]