SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|33469937|ref|NP_877953.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33469937|ref|NP_877953.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-35
Family Laminin G-like module 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|33469937|ref|NP_877953.1|
Sequence length 152
Comment pikachurin isoform 4 [Homo sapiens]
Sequence
MRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGSFNDGRW
HRVKAVRDGQSGKITVDDYGARTGKSPGMMRQLNINGALYVGGMKEIALHTNRQYMRGLV
GCISHFTLSTDYHISLVEDAVDGKNINTCGAK
Download sequence
Identical sequences A0A2J8QA36 A0A2J8WB94
gi|33469937|ref|NP_877953.1| ENSP00000380393 ENSP00000423228 ENSP00000425579 NP_877953.1.87134 NP_877953.1.92137 XP_003310792.1.37143 XP_004058971.1.27298 XP_005909189.1.15283 XP_007095521.1.5354 XP_008961574.1.60992 XP_011284756.1.62641 XP_014923096.1.86478 XP_019319764.1.44245 ENSP00000380393 ENSP00000423228 ENSP00000425579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]