SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33469985|ref|NP_009201.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33469985|ref|NP_009201.2|
Domain Number 1 Region: 143-268
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-39
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 2 Region: 40-154
Classification Level Classification E-value
Superfamily FKBP-like 1.16e-38
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 3 Region: 266-379
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 4 Region: 374-478
Classification Level Classification E-value
Superfamily FKBP-like 1.81e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 5 Region: 484-559
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000679
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33469985|ref|NP_009201.2|
Sequence length 570
Comment peptidyl-prolyl cis-trans isomerase FKBP9 precursor [Homo sapiens]
Sequence
MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYH
YVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGNE
GVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDG
TLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPG
QASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYS
RNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIH
VIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVL
GSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGL
PEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELIVKN
MFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences O95302
ENSP00000242209 9606.ENSP00000242209 ENSP00000242209 NP_009201.2.87134 NP_009201.2.92137 gi|33469985|ref|NP_009201.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]