SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334883159|ref|NP_001229371.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334883159|ref|NP_001229371.1|
Domain Number 1 Region: 119-215
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.61e-31
Family Ras-binding domain, RBD 0.00000432
Further Details:      
 
Domain Number 2 Region: 441-552
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-31
Family SH2 domain 0.000000473
Further Details:      
 
Domain Number 3 Region: 253-366
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000211
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334883159|ref|NP_001229371.1|
Sequence length 555
Comment growth factor receptor-bound protein 7 isoform b [Homo sapiens]
Sequence
MGKWRPGQGHTTGSVKPLSRSDAMELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPE
EVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRD
ASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHPHLALERG
LEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHE
DLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVAD
VNESNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFK
YGVQLYKNYQQAQSRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALE
EAQAWRKKTNHRLSLPMPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLV
RESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRG
ILPCLLRHCCTRVAL
Download sequence
Identical sequences A0A2I3S3A1
NP_001229371.1.87134 NP_001229371.1.92137 gi|334883159|ref|NP_001229371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]