SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334883161|ref|NP_001229372.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334883161|ref|NP_001229372.1|
Domain Number 1 Region: 96-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-31
Family Ras-binding domain, RBD 0.00000432
Further Details:      
 
Domain Number 2 Region: 418-529
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-31
Family SH2 domain 0.000000473
Further Details:      
 
Domain Number 3 Region: 230-343
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000195
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334883161|ref|NP_001229372.1|
Sequence length 532
Comment growth factor receptor-bound protein 7 isoform a [Homo sapiens]
Sequence
MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG
SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
Download sequence
Identical sequences A0A0S2Z4F6 H2QCV3 Q14451
ENSP00000310771 ENSP00000377759 ENSP00000377761 ENSP00000310771 ENSP00000377759 ENSP00000377761 9606.ENSP00000310771 NP_001025173.1.87134 NP_001025173.1.92137 NP_001229372.1.87134 NP_001229372.1.92137 NP_005301.2.87134 NP_005301.2.92137 XP_009430535.2.37143 XP_016787370.1.37143 HR4472 gi|334883161|ref|NP_001229372.1| gi|71979665|ref|NP_005301.2| gi|71979667|ref|NP_001025173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]