SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33598931|ref|NP_663325.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33598931|ref|NP_663325.1|
Domain Number 1 Region: 276-412
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000502
Family Growth factor receptor domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|33598931|ref|NP_663325.1|
Domain Number - Region: 225-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000113
Family Growth factor receptor domain 0.0044
Further Details:      
 
Domain Number - Region: 163-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|33598931|ref|NP_663325.1|
Sequence length 569
Comment scavenger receptor class F member 1 isoform 3 precursor [Homo sapiens]
Sequence
MGLGLLLPLLLLWTRGTQGSELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGP
DACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQC
QADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACV
CKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCP
PGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPG
TFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQ
GSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRD
TALIAGSLVPLLLLFLGLACCACCCWAPRSDLKDRPARDGATVSRMKLQVWGTLTSLGST
LPCRSLSSHKLPWVTASSSRPLPAGPLMTPSHPILSLERQMRFLPTVCHPKKGWSLWPRQ
GRQRPAWLQVLSRPLRTPPRHSPSRAPPA
Download sequence
Identical sequences NP_663325.1.87134 NP_663325.1.92137 ENSP00000458174 gi|33598931|ref|NP_663325.1| ENSP00000458174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]