SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33598948|ref|NP_002651.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33598948|ref|NP_002651.2|
Domain Number 1 Region: 321-483,892-1071
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.19e-124
Family Mammalian PLC 0.00000767
Further Details:      
 
Domain Number 2 Region: 643-757
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-31
Family SH2 domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 545-660
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-27
Family SH2 domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1090-1211
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.57e-25
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 5 Region: 790-851
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-19
Family SH3-domain 0.0000245
Further Details:      
 
Domain Number 6 Region: 26-141
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-19
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 7 Region: 154-314
Classification Level Classification E-value
Superfamily EF-hand 0.000000437
Family Calmodulin-like 0.034
Further Details:      
 
Weak hits

Sequence:  gi|33598948|ref|NP_002651.2|
Domain Number - Region: 485-523
Classification Level Classification E-value
Superfamily PH domain-like 0.000185
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33598948|ref|NP_002651.2|
Sequence length 1291
Comment 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1 isoform a [Homo sapiens]
Sequence
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
Download sequence
Identical sequences 9606.ENSP00000244007 NYSGXRC-13059a NYSGXRC-13059b gi|33598948|ref|NP_002651.2| NP_002651.2.87134 NP_002651.2.92137 ENSP00000244007 ENSP00000244007 ENSP00000244007 ENSP00000362369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]