SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33624861|ref|NP_878914.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33624861|ref|NP_878914.1|
Domain Number 1 Region: 74-189
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000533
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 2 Region: 147-308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000302
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33624861|ref|NP_878914.1|
Sequence length 429
Comment nesprin-2 isoform 2 [Homo sapiens]
Sequence
MEGDRNVPPVPPASSTPYKPPYGKLLLPPGTDGGKEGPRVLNGNPQQEDGGLAGITEQQS
GAFDRWEMIQAQELHNKLKIKQNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEI
ELRVKRLQEILKAFDTYKALVVSVNVSSKEFLQTESPESTELQSRLRQLSLLWEAAQGAV
DSWRGGLRQSLMQCQGSKTRPRSDVLFFKDFHQLSQNLLLWLASAKNRRQKAHVTDPKAD
PRALLECRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQ
LREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRAKFRAVRTTEGEEETES
RVPGSTRPQRSFLSRVVRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPML
RYTNGPPPT
Download sequence
Identical sequences ENSP00000396794 NP_878914.1.87134 NP_878914.1.92137 ENSP00000396794 gi|33624861|ref|NP_878914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]