SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338753361|ref|NP_001186457.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338753361|ref|NP_001186457.2|
Domain Number 1 Region: 242-328,622-706
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000268
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 2 Region: 41-85
Classification Level Classification E-value
Superfamily Elafin-like 0.000000157
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 437-479,824-856
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 189-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000805
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|338753361|ref|NP_001186457.2|
Domain Number - Region: 319-403
Classification Level Classification E-value
Superfamily SEA domain 0.000301
Family SEA domain 0.012
Further Details:      
 
Domain Number - Region: 722-762
Classification Level Classification E-value
Superfamily SEA domain 0.0589
Family SEA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338753361|ref|NP_001186457.2|
Sequence length 1246
Comment uromodulin-like 1 isoform 4 [Homo sapiens]
Sequence
MVYRTQYLVVEVPESRNVTDCCEGYEQLGLYCVLPLNQSGQFTSRPGACPAEGPEPSTSP
CSLDIDCPGLEKCCPWSGGRYCMAPAPQAPERDPVGSWYNVTILVKMDFKELQQVDPRLL
NHMRLLHSLVTSALQPMASTVHHLHSAPGNASTTVSRLLLGLPRPLPVADVSTLLGDIAK
RVYEVISVQVQDVNECFYEELNACSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDC
PPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRSARTQSQALAVAGLEAGV
LYRVKTSYQGCGADVSTTLTIKTNAQVFEVTIKIVNHNLTEKLLNRSSVEYQDFSRQLLH
EVESSFPPVVSDLYRSGKLRMQIVSLQAGSVVVRLKLTVQDPGFPMGISTLAPILQPLLA
STVFQIDRQGTRVQDWDECVDSAEHDCSPAAWCINLEGSYTCQCRTTRDATPSRAGRACE
GDLVSPTGGGLSAATGVTVPGLGTGTAALGLENFTLSPSPGYPQGTPAAGQAWTPEPSPR
RGGSNVVGYDRNNTGKGVEQELQGNSIMEPPSWPSPTEDPTGHFLWHATRSTRETLLNPT
WLRNEDSGPSGSVDLPLTSTLTALKTPACVPVSIGRIMVSNVTSTGFHLAWEADLAMDST
FQLTLTSMWSPAVVLETWNTSVTLSGLEPGVLHLVEIMAKACGKEGARAHLKVRTAARKL
IGKVRIKNVRYSESFRNASSQEYRDFLELFFRMVRGSLPATMCQHMDAGGVRMEVVSVTN
GSIVVEFHLLIIADVDVQEVSAAFLTAFQTVPLLEVIRGDTFIQDYDECERKEDDCVPGT
SCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWATSPERPLTTAGTKAAFVQGT
SPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESIPESSLYLSHPSCNVSHSNGT
HVLLEAGWSECGTLMQSNMTNTVVRTTLRNDLSQEGIIHHLKILSPIYCAFQNDLLTSSG
FTLEWGVYTIIEDLHGAGNFVTEMQLFIGDSPIPQNYSVSASDDVRIEVGLYRQKSNLKV
VLTECWATPSSNARDPITFSFINNSCPVPNTYTNVIENGNSNKAQFKLRIFSFINDSIVY
LHCKLRVCMESPGATCKINCNNFRLLQNSETSATHQMSWGPLIRSEGEPPHAEAGLGAGY
VVLIVVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFSYQVFYE
Download sequence
Identical sequences gi|338753361|ref|NP_001186457.2| NP_001186457.2.87134 NP_001186457.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]