SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338827650|ref|NP_001229759.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338827650|ref|NP_001229759.1|
Domain Number - Region: 119-199
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00106
Family CRAL/TRIO domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|338827650|ref|NP_001229759.1|
Sequence length 262
Comment elongation of very long chain fatty acids protein 5 isoform 3 [Homo sapiens]
Sequence
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSK
LIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSSVCADNHPDQLRGH
LAVHIPSWLVVFPDWIHDFPDCSLHKLLHSDLQQERGLPKERPPEGPPEWVHGCCEWTHQ
QLFTPGKQCEAKEAAEGLKSKN
Download sequence
Identical sequences A0A0A0MTI6 A0A2I2YT31
NP_001229759.1.87134 NP_001229759.1.92137 gi|338827650|ref|NP_001229759.1| ENSP00000440728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]