SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339276000|ref|NP_001106203.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339276000|ref|NP_001106203.2|
Domain Number 1 Region: 594-783
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-53
Family DBL homology domain (DH-domain) 0.00000000721
Further Details:      
 
Domain Number 2 Region: 788-928
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-39
Family Pleckstrin-homology domain (PH domain) 0.000000125
Further Details:      
 
Domain Number 3 Region: 274-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1027-1083
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000945
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 41-195
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000497
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|339276000|ref|NP_001106203.2|
Domain Number - Region: 431-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0317
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|339276000|ref|NP_001106203.2|
Sequence length 1125
Comment guanine nucleotide exchange factor DBS isoform a [Homo sapiens]
Sequence
MRFWLRTEEMALEEMVQRLNAVSKHTDEIMHQDIVPLCAADIQDQLKKRFAYLSGGRGQD
GSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVKASVL
RIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKS
QLTEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSV
LCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLN
ETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAHVEHL
LRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARR
RGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENK
IQELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAP
RPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEESLAI
LRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEIYH
FHNRIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQEC
QRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILKAVND
SMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVL
FCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTP
EIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEER
KTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGL
GPKKLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWVPASS
LSVRLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
Download sequence
Identical sequences ENSP00000440374 NP_001106203.2.87134 NP_001106203.2.92137 ENSP00000440374 gi|339276000|ref|NP_001106203.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]