SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|339276002|ref|NP_079255.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339276002|ref|NP_079255.4|
Domain Number 1 Region: 592-781
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-53
Family DBL homology domain (DH-domain) 0.00000000721
Further Details:      
 
Domain Number 2 Region: 786-926
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-39
Family Pleckstrin-homology domain (PH domain) 0.000000125
Further Details:      
 
Domain Number 3 Region: 272-422
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1025-1081
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000945
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 39-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000497
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  gi|339276002|ref|NP_079255.4|
Domain Number - Region: 429-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0317
Family Spectrin repeat 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|339276002|ref|NP_079255.4|
Sequence length 1123
Comment guanine nucleotide exchange factor DBS isoform b [Homo sapiens]
Sequence
MTVRRLSLLCRDLWALWLLLKAGADEIMHQDIVPLCAADIQDQLKKRFAYLSGGRGQDGS
PVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVKASVLRI
AASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGYIDKSQL
TEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLC
AHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNET
EAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAILDAASQKIATFTDIGNSLAHVEHLLR
DLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHLCDQFSAEIARRRG
LLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQ
ELNAIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRP
EALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRGSAGEEEESLAILR
RHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEIYHFH
NRIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPFFQECQR
KLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALSSILGILKAVNDSM
HLIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFC
KKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEI
KAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNIKKLEERKT
DPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGP
KKLVPGKYTVVADHEKGGPDALRVRSGDVVELVQEGDEGLWYVRDPTTGKEGWVPASSLS
VRLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
Download sequence
Identical sequences ENSP00000364754 NP_079255.4.87134 NP_079255.4.92137 gi|339276002|ref|NP_079255.4| ENSP00000405639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]