SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|33946291|ref|NP_079106.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|33946291|ref|NP_079106.3|
Domain Number 1 Region: 334-495
Classification Level Classification E-value
Superfamily EF-hand 7.1e-21
Family Calmodulin-like 0.008
Further Details:      
 
Domain Number 2 Region: 103-316
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 7.59e-19
Family Glycerol-3-phosphate (1)-acyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|33946291|ref|NP_079106.3|
Sequence length 534
Comment lysophosphatidylcholine acyltransferase 1 [Homo sapiens]
Sequence
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLV
AAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGR
QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQ
DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPN
KLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAE
ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERAR
MKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEEKGKITFADFHRFA
EMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAGRKPVRKKLD
Download sequence
Identical sequences Q8NF37
ENSP00000283415 gi|33946291|ref|NP_079106.3| 9606.ENSP00000283415 NYSGRC-33946291 ENSP00000283415 ENSP00000423472 ENSP00000283415 ENSP00000423472 NP_079106.3.87134 NP_079106.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]