SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34013590|ref|NP_067049.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34013590|ref|NP_067049.2|
Domain Number 1 Region: 151-349
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 33-192
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-32
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Weak hits

Sequence:  gi|34013590|ref|NP_067049.2|
Domain Number - Region: 612-678
Classification Level Classification E-value
Superfamily Tropomyosin 0.000216
Family Tropomyosin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|34013590|ref|NP_067049.2|
Sequence length 698
Comment rho GTPase-activating protein 22 [Homo sapiens]
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCV
DFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPE
PVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV
NKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLFTAPVPEGPTSP
RGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRL
KDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSAR
SSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQ
GLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEEELDQEKKKYIMLEIKLRNSE
RAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK
Download sequence
Identical sequences Q7Z5H3
ENSP00000249601 ENSP00000249601 NP_067049.2.87134 NP_067049.2.92137 9606.ENSP00000249601 gi|34013590|ref|NP_067049.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]